PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00132911001
Common NameGSBRNA2T00132911001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 365aa    MW: 39921 Da    PI: 9.3384
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00132911001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57.2e-3975135262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++l+cprC+stntkfCyynny+l+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ s
  GSBRNA2T00132911001  75 PQEKLNCPRCNSTNTKFCYYNNYNLTQPRYFCKGCRRYWTEGGTLRNVPVGGSSRKNKRLS 135
                          6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2574126IPR003851Zinc finger, Dof-type
PfamPF027013.8E-3377133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.03179133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009416Biological Processresponse to light stimulus
GO:0009845Biological Processseed germination
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDATKWTQGF QEMMNVKPMD QIMIPNNNTH QSNTTSSARP STILTPNGVS AAGATVSGVS  60
NNNNTAVVVE RKARPQEKLN CPRCNSTNTK FCYYNNYNLT QPRYFCKGCR RYWTEGGTLR  120
NVPVGGSSRK NKRLSSSSSS SNILQTTPSS LGLTTTLPDL NPPILFSNQI PNKSKGSSQD  180
LNLLSFPVMQ DQHHRVHMSQ FLQMPKMEGN GNITHQQPSS SSSLYGSSPV SALELLRRGV  240
SVSPNSVMPS GPMMDSSNNV MYTSSGFPTM VDYKPSNLSF STDHHQGTGH NNHNRSDDAH  300
HQGRVLFPFG DQMKELSSSI TQEVDHDDNQ QQKSHGNNNN NISSSPNNGY WSGMFSTTGG  360
GSSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.144940.0seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00319DAPTransfer from AT2G46590Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00132911001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528590.0AK352859.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-N20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013747624.10.0PREDICTED: dof zinc finger protein DOF2.5-like
RefseqXP_009142625.10.0PREDICTED: dof zinc finger protein DOF2.5-like
SwissprotQ9ZPY00.0DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLA0A078CTA20.0A0A078CTA2_BRANA; BnaA05g01260D protein
STRINGBra004525.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46590.21e-156Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]